PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_14079
Common NameKK1_014503
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 332aa    MW: 37743.4 Da    PI: 7.2366
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_14079genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.5e-161369148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.........TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.........kgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G ++W+++++  g         + R++k+c++rw +yl
    C.cajan_14079 13 RGLWSPEEDEKLIRYINTHGHKSWSSVPKFAGrlfsiiyvcLQRCGKSCRLRWINYL 69
                     788****************************************************97 PP

2Myb_DNA-binding55.51.3e-1775118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE+++++d ++ lG++ W+ Ia++++ gRt++++k++w++
    C.cajan_14079  75 RGSFTAEEEQIIIDIHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 118
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-25572IPR009057Homeodomain-like
PROSITE profilePS5129415.472869IPR017930Myb domain
SuperFamilySSF466892.66E-2810116IPR009057Homeodomain-like
SMARTSM007175.0E-121271IPR001005SANT/Myb domain
PfamPF002493.7E-151369IPR001005SANT/Myb domain
CDDcd001671.06E-101669No hitNo description
PROSITE profilePS5129426.46870124IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2673125IPR009057Homeodomain-like
SMARTSM007171.8E-1674122IPR001005SANT/Myb domain
PfamPF002498.7E-1675118IPR001005SANT/Myb domain
CDDcd001676.63E-1277117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGHRCCSKQK IKRGLWSPEE DEKLIRYINT HGHKSWSSVP KFAGRLFSII YVCLQRCGKS  60
CRLRWINYLR PDLKRGSFTA EEEQIIIDIH RILGNRWAQI AKHLPGRTDN EVKNFWNSCI  120
KKKLISQGLD PQTHTLLSSH RRSSACTISN IHQNSNSIFI VSSNIPNAPV ETTSQTFSSL  180
PKAQPNIVQT PSSIVSSEYQ TSTILSNKFS SDLPYELLLE NTSNICSPSY MNPEAVELSN  240
YENNVNWVSR VNVEDFSAQT PEEGTQVQVH QEKNKTCESK GIDVREVNNK GNLETSASFE  300
SSNFDFGLLE SVLTSEFISH DFNCMDELAW NF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31131247108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014500881.10.0PREDICTED: transcription factor MYB86
TrEMBLA0A151SWA90.0A0A151SWA9_CAJCA; Transcription factor MYB86
STRINGGLYMA08G17371.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34663267
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.16e-86myb domain protein 67